Buying a Washing Machine: Invest in High Efficiency

When buying a new washing machine, the smartest move you can make is to invest in a high efficiency appliance.

You might be tempted to save money on a cheaper washing machine, but you’ll get better savings in the long run when you buy a high-efficiency washer.  Purchasing a new washer isn’t something we do every day, so if you’re going to lay out the money, it’s best to buy a machine that will provide maximum benefits – like these:

Energy and Water Savings.  High-efficiency washing machines use half the energy of a conventional washer and a third less water.  Additionally, the spin cycle is super-fast, which means your clothes come out of the machine cleaner and drier than they would with a standard washing machine.  That means your clothing won’t need to spend as much time in the dryer, which means you’re also running the dryer less, sparing your wardrobe from wear and tear, and spending less money.  What could be bad?Alt=buyingawashingmachineinvestinenergyefficiency

Gentler on Your Clothes.  High-efficiency washing machines don’t spin your clothes – they tumble them.  There’s much less friction involved in tumbling than in spinning, which means your clothes will last longer.  And when it comes to delicate items, high-efficiency washing machines provide tender loving care.

Use Less Detergent.  You may have seen laundry detergent packages marked “HE”.  That means the product is specially formulated to work in "high efficiency" washers.  You’ll use about two-thirds less detergent in a high efficiency washer than you would in a conventional washer.  Additionally, your clothes will actually be much cleaner when washed in a high-efficiency machine, because the super-fast spin cycle flushes out the maximum amount of detergent, leaving less residue behind in your clothes.

Comforters & Blankets Are A-OK.  High-efficiency washers can handle large, bulky items like comforters, blankets and sleeping bags with ease.  No more special trips to the Laundromat to use that large-capacity machine.

Buy a high-efficiency washer and you won’t regret it.  You’ll enjoy cost savings, and treat your clothes and bedding better than ever before.

Post new comment

The content of this field is kept private and will not be shown publicly.
Type the characters you see in this picture. (verify using audio)
Type the characters you see in the picture above; if you can't read them, submit the form and a new image will be generated. Not case sensitive.